PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G164500.1.p
Common NameSb03g015050, SORBIDRAFT_03g015050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 233aa    MW: 25441.8 Da    PI: 8.1179
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G164500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.5e-162369148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          + +WT+eEd  l + v+++G+ +W++I++ ++ gR +k+c++rw ++l
  Sobic.003G164500.1.p 23 KSAWTKEEDAVLREQVRLHGPQNWAAISEALP-GRNPKSCRLRWCQHL 69
                          579*****************************.***********9986 PP

2Myb_DNA-binding43.38.4e-1478120347
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           ++Tt+Ede ++   ++++++ W+tIa  ++ gRt++ +k+rw+++
  Sobic.003G164500.1.p  78 PFTTQEDETIIVNYRKYPNK-WATIAGFLP-GRTDNAIKNRWHSV 120
                           79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.3191873IPR017930Myb domain
SuperFamilySSF466894.31E-2921117IPR009057Homeodomain-like
SMARTSM007174.9E-162271IPR001005SANT/Myb domain
PfamPF002491.8E-152369IPR001005SANT/Myb domain
CDDcd001674.85E-152569No hitNo description
Gene3DG3DSA:1.10.10.602.0E-202583IPR009057Homeodomain-like
SMARTSM007174.3E-1075123IPR001005SANT/Myb domain
PROSITE profilePS5129414.96677125IPR017930Myb domain
CDDcd001678.43E-1078121No hitNo description
PfamPF002491.3E-1178121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-1784121IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MAVPDEAASG SGDGRPAPVA MKKSAWTKEE DAVLREQVRL HGPQNWAAIS EALPGRNPKS  60
CRLRWCQHLS PAVDTVRPFT TQEDETIIVN YRKYPNKWAT IAGFLPGRTD NAIKNRWHSV  120
LGKVYHHQQQ QQRAAEPGLH RLSDGTLVLF PLAPGDLKAF GRDMIVPLLR HSPPGVDLSG  180
QCLKLFPLVA GDLARGNSAG EAAAMDVDYS TDESLVELRL WPSTTNHEGG GR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A3e-30231232101MYB3
3zqc_D3e-30231232101MYB3
3zqc_G3e-30231232101MYB3
3zqc_J3e-30231232101MYB3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457840.11e-173hypothetical protein SORBIDRAFT_03g015050
TrEMBLC5XKL11e-173C5XKL1_SORBI; Putative uncharacterized protein Sb03g015050
STRINGSb03g015050.11e-172(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.13e-36myb domain protein 77